TSTAB298521
Antibody against Caenorhabditis elegans efl-1
- Status: released
awaiting characterization
Caenorhabditis elegans
any cell type or tissue
- Source (vendor)
- Novus
- Product ID
- 44960002
- Lot ID
- G3048-110A01
- Host
- rabbit
- Clonality
- polyclonal
- Antigen description
- This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. This antibody is available from different lot and animal productions. These anti-C. elegans antibodies were generated in the labs of Jason
- Antigen sequence
- MEDSYNDMEDPGFRQLSDMELQKALEMTKQSSIKNNLMLGLDNELDFDFDFDEDEDLDQPQMGTRADKSLGLLAKRFIRMIQYSPYGRCD LNTAAEALNV
- External resources