TSTAB305671
Antibody against Homo sapiens HNRNPA1
- Status: released
awaiting characterization
Homo sapiens
any cell type or tissue
- Source (vendor)
- Aviva
- Product ID
- ARP40383_T100
- Lot ID
- QC9473-091124
- Targets
- HNRNPA1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen description
- The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA1
- Antigen sequence
- MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
- External resources