TSTAB504063
Antibody against Drosophila melanogaster kni
- Status: released
awaiting characterization
Drosophila melanogaster
any cell type or tissue
- Source (vendor)
- Kevin White
- Product ID
- non-commercial Kni modENCODE antibody 1
- Lot ID
- unknown
- Host
- rabbit
- Clonality
- polyclonal
- Antigen description
- This is a custom made polyclonal antibody against KNI generated by the White Lab for the modENCODE project.
- Antigen sequence
- QSPFQLPPHLLFPGYHASAAAAAASAADAAYRQEMYKHRQSVDSVESQNRFSPASQPPVVQPTSSARQSPIDVCLEE
- External resources