TSTAB519378
Antibody against Homo sapiens HNRNPK
- Status: released
awaiting characterization
Homo sapiens
any cell type or tissue
- Source (vendor)
- Aviva
- Product ID
- ARP40387_T100
- Lot ID
- QC40387
- Targets
- HNRNPK (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen description
- The immunogen is a synthetic peptide directed towards the C terminal region of human HNRPK
- Antigen sequence
- YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
- External resources