TSTAB718702
Antibody against Drosophila melanogaster D
- Status: released
awaiting characterization
Drosophila melanogaster
any cell type or tissue
- Source (vendor)
- Kevin White
- Product ID
- KW0-D
- Lot ID
- unknown
- Targets
- D (Drosophila melanogaster)
- Host
- rabbit
- Clonality
- polyclonal
- Antigen description
- Antisera raised against a peptide from the Dichaete protein. Produced commercially for the modENCODE Project by K. White's group.
- Antigen sequence
- HQSGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTA
- External resources