TSTAB759620
Antibody against Drosophila melanogaster jumu
- Status: released
awaiting characterization
Drosophila melanogaster
any cell type or tissue
- Source (vendor)
- Kevin White
- Product ID
- Aviva-KW3-jumu-D2
- Lot ID
- unknown
- Host
- rabbit
- Clonality
- polyclonal
- Antigen description
- Antisera raised against a peptide from the Jumeau protein. Produced commercially for the modENCODE Project by K. White's group.
- Antigen sequence
- AVRKDLVTELRKAQSSPVPNSLEELGKGKGSTLLNASVGATNTIKLAPGIGGLTFANSAAYQKLKQTSLVKSPGGIS
- External resources