TSTAB843634
Antibody against Homo sapiens JARID2
- Status: released
awaiting characterization
Homo sapiens
any cell type or tissue
- Source (vendor)
- Santa Cruz Biotech
- Product ID
- sc-134548
- Lot ID
- 1
- Targets
- JARID2 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen description
- Nuclear transcriptional repressor. Jumonji Antibody (H-260) is a rabbit polyclonal IgG provided at 200 åµg/ml. Epitope corresponding to amino acids 961-1220 mapping near the C-terminus of Jumonji of human origin.
- Antigen sequence
- EDVVHTLLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRRHIAKPFSMEKLLYQIAQAEAKKENGPTLSTISALLDELRDTELRQRRQLFEAGLHSSARYGSHDGSSTVADGKKKPRKWLQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPT
- External resources