TSTAB860476
Antibody against Homo sapiens HNRNPH1
- Status: released
awaiting characterization
Homo sapiens
any cell type or tissue
- Source (vendor)
- Aviva
- Product ID
- ARP58479_P050
- Lot ID
- QC25591
- Targets
- HNRNPH1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen description
- A synthetic peptide directed towards the middle region of human HNRNPH1
- Antigen sequence
- FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
- External resources