TSTAB919371
Antibody against Drosophila melanogaster gro
- Status: released
awaiting characterization
Drosophila melanogaster
any cell type or tissue
- Source (vendor)
- Kevin White
- Product ID
- GRO3
- Lot ID
- unknown
- Host
- rabbit
- Clonality
- polyclonal
- Antigen description
- Antisera raised against a peptide from the GRO protein. Produced commercially for the modENCODE Project by K. White's group. Used with a cross-linking condition of 3% formaldehyde.
- Antigen sequence
- IKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGQQIHA
- External resources