TSTAB919849
Antibody against Drosophila melanogaster Cp190
- Status: released
awaiting characterization
Drosophila melanogaster
any cell type or tissue
- Source (vendor)
- Callaini Guiliano
- Product ID
- 1
- Lot ID
- unknown
- Host
- rabbit
- Clonality
- polyclonal
- Antigen description
- Antisera raised against a peptide from the CP190 protein. This is a gift from Callaini Lab to Robert White for modENCODE. Non-commercial Cp190 modENCODE antibody 1
- Antigen sequence
- MGEVKSVKVDNWGVFFLQKLQNFFNKTDYCDLTLQFRDNSQLKVHRLVLS
- External resources