TSTAB951197
Antibody against Homo sapiens HNRNPL
- Status: released
awaiting characterization
Homo sapiens
any cell type or tissue
- Source (vendor)
- Aviva
- Product ID
- ARP40368_P050
- Lot ID
- QC9464
- Targets
- HNRNPL (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen description
- A synthetic peptide directed towards the N terminal region of human HNRNPL
- Antigen sequence
- AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
- External resources